Entrez nucleotide Query

Other Formats: [FASTA Format] [Graphical View]
Links: [1 protein link] [1 nucleotide neighbor]

LOCUS       AF019759     2199 bp    mRNA            MAM       22-SEP-1997
DEFINITION  Canis familiaris beta-glucuronidase (GUSB) mRNA, complete cds.
ACCESSION   AF019759
NID         g2425090
KEYWORDS    .
SOURCE      dog.
  ORGANISM  Canis familiaris
            Eukaryotae; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria;
            Carnivora; Fissipedia; Canidae; Canis.
REFERENCE   1  (bases 1 to 2199)
  AUTHORS   Ray,J., Bouvet,A.B., DeSanto,C., Fyfe,J.C., Wu,D., Wolfe,J.H.,
            Aguirre,G.D., Patterson,D.F., Haskins,M.E. and Henthorn,P.S.
  TITLE     Cloning of canine beta-glucuronidase
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2199)
  AUTHORS   Henthorn,P.S., Fyfe,J.C. and Bouvet,A.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-AUG-1997) Section of Medical Genetics, University of
            Pennsylvania School of Veterinary Medicine, 3900 Delancey St.,
            Philadelphia, PA 19104, USA
FEATURES             Location/Qualifiers
     source          1..2199
                     /organism="Canis familiaris"
                     /db_xref="taxon:9615"
     gene            1..2199
                     /gene="GUSB"
     CDS             63..2018
                     /gene="GUSB"
                     /EC_number="3.2.1.31"
                     /note="lysosomal enzyme"
                     /codon_start=1
                     /product="beta-glucuronidase"
                     /db_xref="PID:g2425091"
                     /translation="MSRGPAGAWVALGPLLWTCGLALEGGMLYPRESPSRERKDLDGL
                     WSFRADFSDGRRQGFEQQWYRAPLRESGPTLDMPVPSSFNDVGQDRQLRSFVGWVWYE
                     REATLPRRWSQDPGTRVVLRIGSAHYYAIVWVNGVHVAEHEGGHLPFEADISKLVQSG
                     PLSSCRITLAINNTLTPHTLPPGTIVYKTDASKYPKGYFVQNTYFDFFNYAGLHRPVL
                     LYTTPTTYIDDITVTTGVDQDTGLVDYQIFVQGSEHFQLEVYLLDEEGKVVAQGTGSQ
                     GRLQVPNVHLWWPYLMHEHPAYLYSLEVRLTAQMAAGPVSDFYTLPVGIRTVAVTERQ
                     FLINGKPFYFHGVNKHEDADIRGKGFDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVM
                     QLCDRYGIVVIDESPGVGIMLVQSYSNVSLQHHLEVMGELVRRDKNHPSVVMWSVANE
                     PTSFLKPAAYYFKTLIAHTKALDPSRPVTFVTNSNYEADLGAPYVDVICVNSYYSWYH
                     DYGHMEVIQLQLATEFENWYRTYQKPIIQSEYGAETIAGFHQDPPLMFSEEYQKGLLE
                     QYHLVLDQKRKEYVVGELIWNFADFMTDQSPQRAVGNRKGIFTRQRQPKAAAFLLRER
                     YWKLANETGHHRSAAKSQCLENSPFAL"
BASE COUNT      457 a    639 c    668 g    435 t
ORIGIN      
        1 cggggctgcg ggctgcgggc tgcgggctgc gcgccggggc cacgcgcggc cgcgacggaa
       61 gcatgtctcg ggggccggcg ggggcctggg tagcgctcgg cccgctgctt tggacctgcg
      121 ggctggcgct ggagggcggg atgctgtacc cccgggagag cccgtcgcgg gagcgcaagg
      181 acctcgacgg cctctggagc ttccgcgccg acttctccga cggccggcgc cagggcttcg
      241 agcagcagtg gtaccgggcg ccgctgcgcg agtcgggccc caccctggac atgccagttc
      301 cgtccagctt caatgatgtg ggccaggata ggcagctgcg cagctttgtc ggctgggtgt
      361 ggtacgagcg ggaggccacc ctgccccggc gatggagcca ggacccgggc acgagagtgg
      421 tgctgaggat tggcagcgcc cactactatg ccatcgtgtg ggtgaatggg gtccatgtgg
      481 cagagcacga ggggggtcac ctccccttcg aagctgacat cagcaagttg gtccagagcg
      541 ggcccctgtc ctcctgccgt attacccttg ccatcaacaa cacgctcacc ccccacactc
      601 tgccgccagg gaccatcgtc tacaagacag acgcttccaa gtaccccaag ggttacttcg
      661 tccagaacac atactttgac ttcttcaact acgcgggcct gcatcgccct gtgctcctct
      721 acaccacacc tactacctac atcgacgaca tcaccgtcac caccggcgtg gaccaagaca
      781 ctgggctggt ggattaccag atttttgtcc agggcagtga acacttccag ctggaagtgt
      841 atcttctgga tgaggaaggc aaggtcgtgg cccaggggac agggagccag ggccggctgc
      901 aggtgcccaa tgtccacctc tggtggccgt acctgatgca tgagcacccc gcctacctgt
      961 actcgttgga ggtgaggctg actgcgcaga tggccgctgg gcctgtgtca gacttctata
     1021 ctctccccgt ggggattcgc accgtggccg tcacagagcg ccagttcctc atcaacggga
     1081 aacctttcta tttccatggg gtcaacaaac atgaggatgc cgatatccga gggaagggct
     1141 ttgactggcc gctgctggtg aaggacttca acctgttgcg ctggctgggc gccaatgcct
     1201 tccgcaccag ccactacccc tacgcggagg aggtgatgca gctctgcgac cgctatggga
     1261 tcgtggtcat cgacgagagc cctggtgtgg gcatcatgct ggtccagagc tacagcaatg
     1321 tgtccctgca gcaccatctg gaggtgatgg gggagctggt gcgtcgggat aagaatcacc
     1381 catctgtagt catgtggtct gtagccaatg agcccacttc cttcctgaag cctgctgctt
     1441 actacttcaa gacgctgatt gctcacacca aggccttgga cccctcccgg cccgtgacct
     1501 ttgtgaccaa ttccaactat gaagcagacc tgggggcgcc gtatgtggac gtcatctgtg
     1561 tcaacagtta ctactcttgg tatcacgact atgggcacat ggaggtgatt cagctgcagc
     1621 tggccaccga gtttgagaac tggtatagga cctaccagaa accaataatc cagagcgagt
     1681 acggggcaga gacaattgca ggcttccacc aggatccacc tctgatgttc agtgaggagt
     1741 accagaaagg tctgctcgag cagtatcact tggtgctgga tcagaaacgc aaagaatatg
     1801 tggttggaga gctcatctgg aattttgctg attttatgac tgaccagtca ccacagagag
     1861 cagtagggaa cagaaagggc atcttcactc gccagagaca acccaaagcg gcggccttcc
     1921 ttttgcgaga gaggtactgg aaacttgcca atgaaaccgg gcaccaccgg tccgcggcca
     1981 agtcccagtg tttggaaaac agcccgttcg ccctctgaag cctctgtctg ccccggaggg
     2041 gaagggacca cgtccacgga ccccatggac cgcgtgtggc cgcctgggac gttcctgcct
     2101 gcagcctgta ctgattcact ggaagggaat cttagaggtg gaaataaagg cttttgttgt
     2161 gtgtgaataa agagtcatct tagaaaaaaa aaaaaaaaa
//



the above report in format


Pour revenir utiliser la touche "back" de votre navigateur

To Exit, Press the Previous Page Key in the Toolbar of your Explorer